PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G001000.1
Common NamePHAVU_008G001000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family NAC
Protein Properties Length: 242aa    MW: 27623.3 Da    PI: 10.0576
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G001000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1676.5e-52141381128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelvv+yLk+kv + +l++ +vi+evd++k++PwdLp      eke yfFs+++ ky++g+r+nrat+sgyWkatg dk+
  Phvul.008G001000.1  14 LPPGFRFHPTDEELVVQYLKRKVFSFPLPA-SVIPEVDVCKSDPWDLPGD---LEKERYFFSTKEPKYPNGNRSNRATNSGYWKATGLDKQ 100
                         79****************************.99***************54...46899********************************* PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++++ ++++vg+kktLvfy+g+ p+g++tdW+mheyrl
  Phvul.008G001000.1 101 IVTSkGNQVVGMKKTLVFYRGKPPHGSRTDWIMHEYRL 138
                         998857778***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.05E-6010167IPR003441NAC domain
PROSITE profilePS5100558.39614167IPR003441NAC domain
PfamPF023652.0E-2715138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010089Biological Processxylem development
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MEKLNFVKNG ELRLPPGFRF HPTDEELVVQ YLKRKVFSFP LPASVIPEVD VCKSDPWDLP  60
GDLEKERYFF STKEPKYPNG NRSNRATNSG YWKATGLDKQ IVTSKGNQVV GMKKTLVFYR  120
GKPPHGSRTD WIMHEYRLLN APTSSLSQSP VVEVPMENWV LCRIFLKRRS GSRNGEEKEM  180
ESLRGRVDKG MVRKSKMVFY NFMAQNKSDS SNSGASGVTN ESDEHEESSS SNTFPYIRRK  240
P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-521117314171NO APICAL MERISTEM PROTEIN
1ut4_B1e-521117314171NO APICAL MERISTEM PROTEIN
1ut7_A1e-521117314171NO APICAL MERISTEM PROTEIN
1ut7_B1e-521117314171NO APICAL MERISTEM PROTEIN
3swm_A1e-521117317174NAC domain-containing protein 19
3swm_B1e-521117317174NAC domain-containing protein 19
3swm_C1e-521117317174NAC domain-containing protein 19
3swm_D1e-521117317174NAC domain-containing protein 19
3swp_A1e-521117317174NAC domain-containing protein 19
3swp_B1e-521117317174NAC domain-containing protein 19
3swp_C1e-521117317174NAC domain-containing protein 19
3swp_D1e-521117317174NAC domain-containing protein 19
4dul_A1e-521117314171NAC domain-containing protein 19
4dul_B1e-521117314171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00507DAPTransfer from AT5G13180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6619141e-145EU661914.1 Glycine max NAC domain protein (NAC14) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007139098.11e-180hypothetical protein PHAVU_008G001000g
SwissprotQ9FY931e-99NAC83_ARATH; NAC domain-containing protein 83
TrEMBLV7AZL01e-180V7AZL0_PHAVU; Uncharacterized protein
STRINGGLYMA18G53954.11e-135(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.17e-98NAC domain containing protein 83